Antibodies

View as table Download

Rabbit Polyclonal antibody to UQCRFS1 (ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 274 of UQCRFS1 (Uniprot ID#P47985)

Rabbit Polyclonal Anti-UQCRFS1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UQCRFS1 antibody: synthetic peptide directed towards the N terminal of human UQCRFS1. Synthetic peptide located within the following region: MLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFL

Carrier-free (BSA/glycerol-free) UQCRFS1 mouse monoclonal antibody,clone OTI4H8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

UQCRFS1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 79-274 of human UQCRFS1 (NP_005994.2).
Modifications Unmodified

UQCRFS1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 79-274 of human UQCRFS1 (NP_005994.2).
Modifications Unmodified

Complex III Subunit 5 Rabbit monoclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Complex III Subunit 5 Rabbit monoclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

UQCRFS1 mouse monoclonal antibody,clone OTI4H8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

UQCRFS1 mouse monoclonal antibody,clone OTI4H8, Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

UQCRFS1 mouse monoclonal antibody,clone OTI4H8, HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

UQCRFS1 mouse monoclonal antibody,clone OTI4H8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated