Antibodies

View as table Download

Rabbit Polyclonal Anti-LHPP Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Lhpp antibody is: synthetic peptide directed towards the C-terminal region of Lhpp. Synthetic peptide located within the following region: VGDVGGAQQCGMRALQVRTGKFRPGDEHHPEVQADGYVDNLAEAVDLLLK

LHPP Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human LHPP (NP_071409.3).
Modifications Unmodified