Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal NURR1 (NR4A2) Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This NURR1 (NR4A2) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-42 amino acids from the N-terminal region of human NURR1 (NR4A2). |
Rabbit Polyclonal Anti-NR4A2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR4A2 antibody: synthetic peptide directed towards the N terminal of human NR4A2. Synthetic peptide located within the following region: MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTE |
NR4A2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic Peptide of human NR4A2. |
| Modifications | Unmodified |