Goat Anti-PEX2 / PXMP3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-NATVGQSVLNIKYKN, from the Internal region of the protein sequence according to NP_000309.1. |
Goat Anti-PEX2 / PXMP3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-NATVGQSVLNIKYKN, from the Internal region of the protein sequence according to NP_000309.1. |
Rabbit Polyclonal anti-Pxmp3 antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Pxmp3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MQSANRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVK |
PEX2 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human PEX2 (NP_001165558.1). |
Modifications | Unmodified |