Antibodies

Jump to Filters
View as table Download
GPD1L (N-term) Rabbit Polyclonal Antibody
AP51905PU-N

USD 450.00

2 Weeks

GPD1L (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 47-77 amino acids from the N-terminal region of human GPD1L
GPD1L Rabbit Polyclonal Antibody
TA333844

USD 375.00

5 Days

Rabbit Polyclonal Anti-GPD1L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GPD1L Antibody: synthetic peptide directed towards the middle region of human GPD1L. Synthetic peptide located within the following region: ELEKEMLNGQKLQGPQTSAEVYRILKQKGLLDKFPLFTAVYQICYESRPV
GPD1L Rabbit Polyclonal Antibody
TA366226

USD 380.00

4 Weeks

GPD1L rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human GPD1L
GPD1L Rabbit Polyclonal Antibody
TA376703

USD 220.00

3 Weeks

GPD1L Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-351 of human GPD1L (NP_055956.1).
Modifications Unmodified