Antibodies

Jump to Filters
View as table Download
Kv1.8 (KCNA10) Rabbit Polyclonal Antibody
TA372526

USD 380.00

4 Weeks

KCNA10 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNA10
Kv1.8 (KCNA10) Rabbit Polyclonal Antibody
TA338556

USD 310.00

5 Days

Rabbit Polyclonal Anti-KCNA10 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNA10 antibody: synthetic peptide directed towards the middle region of human KCNA10. Synthetic peptide located within the following region: PANVPIDIFADEISFYELGSEAMDQFREDEGFIKDPETLLPTNDIHRQFW
Kv1.8 (KCNA10) Rabbit Polyclonal Antibody
TA338555

USD 375.00

5 Days

Rabbit Polyclonal Anti-KCNA10 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNA10 antibody: synthetic peptide directed towards the N terminal of human KCNA10. Synthetic peptide located within the following region: DVCGWKEMEVALVNFDNSDEIQEEPGYATDFDSTSPKGRPGGSSFSNGKI
Kv1.8 (KCNA10) Rabbit Polyclonal Antibody
TA328637

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-KV1.8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)KDPETLLPTNDIHCR, corresponding to amino acid residues 187- 200 of human KV1.8. Intracellular, N-terminus.
KCNA10 Rabbit Polyclonal Antibody
TA368289

USD 380.00

4 Weeks

KCNA10 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNA10
Kv1.8 (KCNA10) Rabbit Polyclonal Antibody
TA377692

USD 220.00

3 Weeks

KCNA10 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human KCNA10 (NP_005540.1).
Modifications Unmodified