Rabbit polyclonal Anti-KV1.4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GST fusion protein with sequence PYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCGKEE KCQGKGDDSETDKNNCSNAKAVETDV, corresponding to amino acid residues 589-655 of rat KV1.4. Intracellular, C-terminus. |
Mouse Monoclonal Anti-Kv1.4 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
KCNA4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human KCNA4 (NP_002224.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China