Antibodies

View as table Download

Goat Anti-MECL1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-PTEPVKRSGRYH, from the internal region of the protein sequence according to NP_002792.1.

PSMB10 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 213-242 amino acids from the C-terminal region of Human PSMB10

Rabbit polyclonal Anti-PSMB10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMB10 antibody: synthetic peptide directed towards the middle region of human PSMB10. Synthetic peptide located within the following region: DLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQG

PSMB10 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PSMB10

PSMB10 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PSMB10

PSMB10 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-273 of human PSMB10 (NP_002792.1).
Modifications Unmodified

PSMB10 Rabbit monoclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated