Antibodies

Jump to Filters
View as table Download
CLEC2D Rabbit Polyclonal Antibody
TA349280

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-CLEC2D Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CLEC2D
CLEC2D (122-131) Goat Polyclonal Antibody
AP23056PU-N

USD 440.00

2 Weeks

CLEC2D (122-131) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Equine, Human, Monkey
Immunogen Synthetic peptide from internal region of human CLEC2D
CLEC2D Rabbit Polyclonal Antibody
TA336182

USD 375.00

5 Days

Rabbit Polyclonal Anti-CLEC2D Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CLEC2D Antibody is: synthetic peptide directed towards the C-terminal region of Human CLEC2D. Synthetic peptide located within the following region: GQPWKWINGTEWTRQLVMKEDGANLYVAKVSQVPRMNPRPVMVSYPGSRR
CLEC2D Rabbit Polyclonal Antibody
TA368782

USD 380.00

4 Weeks

CLEC2D rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CLEC2D
CLEC2D Rabbit Polyclonal Antibody
TA374866

USD 220.00

3 Weeks

CLEC2D Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 60-154 of human CLEC2D (NP_037401.1).
Modifications Unmodified