Rabbit Polyclonal Anti-CSTF2T Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CSTF2T antibody: synthetic peptide directed towards the C terminal of human CSTF2T. Synthetic peptide located within the following region: MRGPVPSSRGPMTGGIQGPGPINIGAGGPPQGPRQVPGISGVGNPGAGMQ |
Rabbit Polyclonal Anti-CSTF2T Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CSTF2T antibody: synthetic peptide directed towards the C terminal of human CSTF2T. Synthetic peptide located within the following region: AGIQGGGMQGAGIQGVSIQGGGIQGGGIQGASKQGGSQPSSFSPGQSQVT |
Rabbit polyclonal anti-CSTF2T antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CSTF2T. |
CSTF2T Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 420-560 of human CSTF2T (NP_056050.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
