Rabbit Polyclonal Anti-EXOSC4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EXOSC4 antibody: synthetic peptide directed towards the N terminal of human EXOSC4. Synthetic peptide located within the following region: SDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHE |
EXOSC4 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human EXOSC4 |
EXOSC4 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-245 of human EXOSC4 (NP_061910.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
