Germany
Japan
United Kingdom
China
Fbxl3 (1-5) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Mouse |
| Immunogen | Peptide sequence around aa.1~5 derived from mouse FBXL3 |
Antibodies
View as table Download
Fbxl3 (1-5) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Mouse |
| Immunogen | Peptide sequence around aa.1~5 derived from mouse FBXL3 |
Goat Polyclonal Antibody against FBXL3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KRGGRDSDRNSSEE-C, from the N Terminus of the protein sequence according to NP_036290.1. |
Rabbit Polyclonal Anti-FBXL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FBXL3 antibody: synthetic peptide directed towards the middle region of human FBXL3. Synthetic peptide located within the following region: LISTARPSFMDLPKSHFISALTVVFVNSKSLSSLKIDDTPVDDPSLKVLV |
Fbxl3 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Active filters
Category
- Antibodies
Target Symbol
- FBXL3