GABARAPL2 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human GABARAPL2 |
GABARAPL2 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human GABARAPL2 |
Rabbit Polyclonal Anti-GABARAPL2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABARAPL2 antibody: synthetic peptide directed towards the N terminal of human GABARAPL2. Synthetic peptide located within the following region: KWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLV |
Rabbit Polyclonal Anti-Gabarapl2 Antibody
Applications | WB |
Reactivities | Rat |
Immunogen | The immunogen for anti-Gabarapl2 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: KRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTF |
GABARAPL2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GABARAPL2 |
GABARAPL2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GABARAPL2 |
GABARAPL2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human GABARAPL2 (NP_009216.1). |
Modifications | Unmodified |
GABARAPL2 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human GABARAPL2 (NP_009216.1). |
Modifications | Unmodified |
GABARAPL2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human GABARAPL2 |
GABARAPL2 Rabbit monoclonal Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |