Antibodies

Jump to Filters
View as table Download
HMGCLL1 Rabbit Polyclonal Antibody
TA335959

USD 375.00

5 Days

Rabbit Polyclonal Anti-HMGCLL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HMGCLL1 Antibody: synthetic peptide directed towards the N terminal of human HMGCLL1. Synthetic peptide located within the following region: MGNVPSAVKHCLSYQQLLREHLWIGDSVAGALDPAQETSQLSGLPEFVKI
HMGCLL1 Rabbit Polyclonal Antibody
TA366221

USD 380.00

4 Weeks

HMGCLL1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HMGCLL1
HMGCLL1 Rabbit Polyclonal Antibody
TA370572

USD 380.00

4 Weeks

HMGCLL1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HMGCLL1