Antibodies

View as table Download

Involucrin (IVL) mouse monoclonal antibody, clone IL-9, Purified

Applications IF, IHC, IP, WB
Reactivities Canine, Human, Porcine

Rabbit polyclonal Involucrin antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Involucrin.

Rabbit Polyclonal Anti-IVL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IVL antibody: synthetic peptide directed towards the N terminal of human IVL. Synthetic peptide located within the following region: AENPEQQLKQEKTQRDQQLNKQLEEEKKLLDQQLDQELVKRDEQLGMKKE

Rabbit Polyclonal Anti-Involucrin Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Involucrin Antibody: A synthesized peptide derived from human Involucrin

Involucrin (IVL) (420-578) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen IVL antibody was raised against recombinant protein encoding aa 420-578 of human involucrin

Mouse monoclonal Anti-Involucrin Clone SY5

Reactivities Human, Primate, Dog, Pig
Conjugation Unconjugated

Mouse monoclonal Anti-Involucrin Clone SY8

Reactivities Human, Primate, Dog, Pig
Conjugation Unconjugated

Rabbit Polyclonal Anti-IVL Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human IVL

IVL Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 416-585 of human IVL (NP_005538.2).
Modifications Unmodified