Rabbit Polyclonal Anti-KCTD10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCTD10 antibody: synthetic peptide directed towards the N terminal of human KCTD10. Synthetic peptide located within the following region: MEEMSGESVVSSAVPAAATRTTSFKGTSPSSKYVKLNVGGALYYTTMQTL |
Rabbit Polyclonal Anti-KCTD10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCTD10 antibody: synthetic peptide directed towards the middle region of human KCTD10. Synthetic peptide located within the following region: EETLNILLYEAQDGRGPDNALLEATGGAAGRSHHLDEDEERERIERVRRI |
KCTD10 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human KCTD10 (NP_114160.1). |
| Modifications | Unmodified |
KCTD10 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human KCTD10 (NP_114160.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China