Antibodies

Jump to Filters
View as table Download
BRP44L (MPC1) Rabbit Polyclonal Antibody
TA315496

USD 345.00

4 Weeks

Rabbit polyclonal anti-MPC1 / BRP44L antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human BRP44L.
BRP44L (MPC1) Rabbit Polyclonal Antibody
TA345066

USD 475.00

5 Days

Rabbit Polyclonal Anti-MPC1 Antibody - N-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Mpc1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Mpc1. Synthetic peptide located within the following region: GALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIIS
MPC1 Rabbit Polyclonal Antibody
TA365211

USD 380.00

4 Weeks

MPC1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MPC1
MPC1 Rabbit Polyclonal Antibody
TA369526

USD 380.00

4 Weeks

MPC1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
BRP44L (MPC1) Rabbit Polyclonal Antibody
TA378609

USD 220.00

3 Weeks

MPC1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MPC1.
Modifications Unmodified