Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-NPAS4 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NPAS4. |
Antibodies
View as table Download
Rabbit Polyclonal Npas4 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Goat Anti-NPAS4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CRFNTSKSLRRQS, from the internal region of the protein sequence according to NP_849195.2. |
Rabbit Polyclonal Anti-NPAS4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NPAS4 antibody: synthetic peptide directed towards the middle region of human NPAS4. Synthetic peptide located within the following region: QAHLDSPSQTFPEQLSPNPTKTYFAQEGCSFLYEKLPPSPSSPGNGDCTL |
Active filters
Category
- Antibodies
Target Symbol
- NPAS4