Rabbit polyclonal anti-OR9Q1 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OR9Q1. |
Rabbit polyclonal anti-OR9Q1 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OR9Q1. |
OR9Q1 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 282-312 amino acids from the C-terminal region of human Olfactory receptor 9Q1 |
Rabbit Polyclonal Anti-OR9Q1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-OR9Q1 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR9Q1. Synthetic peptide located within the following region: SQAKTFSTCTSHLTAVSLFFGTLIFMYLRGNSDQSSEKNRVVSVLYTEVI |