Germany
Japan
United Kingdom
China
Goat Anti-ORC6L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-ENAASAQKATAE, from the C Terminus of the protein sequence according to NP_055136.1. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-ORC6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ORC6 antibody is: synthetic peptide directed towards the N-terminal region of Human ORC6. Synthetic peptide located within the following region: KAEEYLRLSRVKCVGLSARTTETSSAVMCLDLAASWMKCPLDRAYLIKLS |
Rabbit Polyclonal Anti-ORC6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ORC6 antibody: synthetic peptide directed towards the C terminal of human ORC6. Synthetic peptide located within the following region: VEAPAKEMEKVEEMPHKPQKDEDLTQDYEEWKRKILENAASAQKATAE |
ORC6 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-252 of human ORC6 (NP_055136.1). |
| Modifications | Unmodified |
ORC6 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-252 of human ORC6 (NP_055136.1). |
| Modifications | Unmodified |
Active filters
Category
- Antibodies
Target Symbol
- ORC6