Rabbit polyclonal anti-PXMP3 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human PXMP3. |
Rabbit polyclonal anti-PXMP3 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human PXMP3. |
PEX2 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the center region (between 172-202aa) of human Peroxin 2 / PEX2 / RNF72 |
Goat Anti-PEX2 / PXMP3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-NATVGQSVLNIKYKN, from the Internal region of the protein sequence according to NP_000309.1. |
Rabbit Polyclonal anti-Pxmp3 antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Pxmp3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MQSANRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVK |
PEX2 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle terminal region of human PEX2 |
PEX2 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human PEX2 (NP_001165558.1). |
Modifications | Unmodified |