Antibodies

Jump to Filters
View as table Download
Peptidase inhibitor 16 (PI16) Rabbit Polyclonal Antibody
TA330942

USD 375.00

5 Days

Rabbit polyclonal Anti-PI16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PI16 antibody: synthetic peptide directed towards the middle region of human PI16. Synthetic peptide located within the following region: SKSLPNFPNTSATANATGGRALALQSSLPGAEGPDKPSVVSGLNSGPGHV