Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-KAPCB antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human KAPCB. |
Rabbit Polyclonal Anti-PRKACB Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKACB antibody: synthetic peptide directed towards the middle region of human PRKACB. Synthetic peptide located within the following region: NGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDI |
Rabbit Polyclonal Anti-PRKACB Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKACB antibody: synthetic peptide directed towards the N terminal of human PRKACB. Synthetic peptide located within the following region: MGNAATAKKGSEVESVKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTL |
PRKACB Antibody - C-terminal region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of mouse PRKACB |
PRKACB rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PRKACB |
PRKACB rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PRKACB |
PRKACB Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-351 of human PRKACB (NP_002722.1). |
| Modifications | Unmodified |
Active filters
Category
- Antibodies
Target Symbol
- PRKACB
Filter by
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Modifications
Families
Pathways
- Apoptosis (4)
- Calcium signaling pathway (4)
- Chemokine signaling pathway (4)
- Dilated cardiomyopathy (4)
- Gap junction (4)
- GnRH signaling pathway (4)
- Hedgehog signaling pathway (4)
- Insulin signaling pathway (4)
- Long-term potentiation (4)
- MAPK signaling pathway (4)
- Melanogenesis (4)
- Olfactory transduction (4)
- Oocyte meiosis (4)
- Prion diseases (4)
- Progesterone-mediated oocyte maturation (4)
- Taste transduction (4)
- Vascular smooth muscle contraction (4)
- Vibrio cholerae infection (4)
- Wnt signaling pathway (4)