Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-RHOD antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RHOD. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-RHOD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RHOD antibody: synthetic peptide directed towards the N terminal of human RHOD. Synthetic peptide located within the following region: TAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVF |
Rabbit Polyclonal Anti-RHOD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RHOD antibody: synthetic peptide directed towards the C terminal of human RHOD. Synthetic peptide located within the following region: NGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVHAVFQEAAEVALSSRG |
RHOD Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human RHOD (NP_055393.1). |
| Modifications | Unmodified |
Active filters
Category
- Antibodies
Target Symbol
- RHOD