Antibodies

View as table Download

Rabbit Polyclonal RNF168 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen RNF168 antibody was raised against an 18 amino acid peptide from near the carboxy terminus of human RNF168.

Rabbit Polyclonal Anti-RNF168 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNF168 antibody: synthetic peptide directed towards the C terminal of human RNF168. Synthetic peptide located within the following region: PCFSAKRRKVSPESSPDQEETEINFTQKLIDLEHLLFERHKQEEQDRLLA

RNF168 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 300-571 of human RNF168 (NP_689830.2).
Modifications Unmodified

Rabbit polyclonal anti-RNF168 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human RNF168

Rabbit polyclonal anti-RNF168 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human RNF168