Antibodies

cDNA Clones (24)
Antibodies (3)
Jump to Filters
View as table Download
SLC35B2 (C-term) Rabbit Polyclonal Antibody
AP53780PU-N

USD 450.00

2 Weeks

SLC35B2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 400-429 amino acids from the C-terminal region of Human SLC35B2 (NP_835361.1)
SLC35B2 Rabbit Polyclonal Antibody
TA331358

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC35B2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC35B2 antibody is: synthetic peptide directed towards the C-terminal region of Human SLC35B2. Synthetic peptide located within the following region: CLLYGHTVTVVGGLGVAVVFAALLLRVYARGRLKQRGKKAVPVESPVQKV
SLC35B2 Rabbit Polyclonal Antibody
TA358957

USD 360.00

5 Days

SLC35B2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human SLC35B2