Germany
Japan
United Kingdom
China
Antibodies
View as table Download
VGLL4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 96-296 of human VGLL4 (NP_001121691.1). |
VGLL4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 96-296 of human VGLL4 (NP_001121691.1). |
Rabbit Polyclonal Anti-VGLL4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-VGLL4 Antibody is: synthetic peptide directed towards the middle region of Human VGLL4. Synthetic peptide located within the following region: GLEQPLALTKNSLDASRPAGLSPTLTPGERQQNRPSVITCASAGARNCNL |
Rabbit Polyclonal Anti-VGLL4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-VGLL4 Antibody is: synthetic peptide directed towards the middle region of Human VGLL4. Synthetic peptide located within the following region: HSGCAAPGPASYRRPPSAATTCDPVVEEHFRRSLGKNYKEPEPAPNSVSI |
Active filters
Category
- Antibodies
Target Symbol
- VGLL4