Mouse Monoclonal DNMT3A Antibody (64B1446)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Mouse Monoclonal DNMT3A Antibody (64B1446)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-DNMT3A Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-DNMT3A antibody is: synthetic peptide directed towards the C-terminal region of Human DNMT3A. Synthetic peptide located within the following region: STVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKE |