Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 22 of 22 results

(reset)

BDNF Rabbit Polyclonal Antibody

TA328615

USD 585.00

2 Weeks

Rabbit Polyclonal Anti-BDNF

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Peptide (C)VLEKVPVSKQLK, corresponding to amino acid residues 166-178 of human BDNF (precursor).

1 / 2

2 / 2

Previous Next

NGF Rabbit Polyclonal Antibody

TA349414

USD 380.00

In Stock

Rabbit Polyclonal Anti-NGF Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human NGF

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

TNF alpha (TNF) Rabbit Polyclonal Antibody

AP20373PU-N

USD 370.00

In Stock

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.

1 / 2

2 / 2

Previous Next

IL1 beta (IL1B) Rabbit Polyclonal Antibody

TA336742

USD 424.00

2 Weeks

Rabbit Polyclonal IL-1 beta/IL-1F2 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide made to a C-terminal portion of the human IL 1 beta protein (between amino acids 100-200) [UniProt P01584]

1 / 2

2 / 2

Previous Next

EGFR Rabbit Polyclonal Antibody

TA312545

USD 345.00

4 Weeks

Rabbit polyclonal EGFR (Ab-1172) antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q).

1 / 3

2 / 3

3 / 3

Previous Next

FGF2 Rabbit Polyclonal Antibody

TA346315

USD 475.00

5 Days

Rabbit Polyclonal Anti-FGF2 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2. Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

1 / 2

2 / 2

Previous Next

PLA2G3 Rabbit Polyclonal Antibody

TA308426

USD 415.00

2 Weeks

Rabbit polyclonal antibody to PLA2G3 (phospholipase A2, group III)

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 263 and 502 of PLA2G3 (Uniprot ID#Q9NZ20)

BDNF Rabbit Polyclonal Antibody

TA328614

USD 585.00

2 Weeks

Rabbit Polyclonal Anti-proBDNF

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Peptide (C)DEDQKVRPNEENNKDAD, corresponding to amino acid residues 72-88 of human BDNF (precursor). Pro-domain of the BDNF protein.

1 / 3

2 / 3

3 / 3

Previous Next

FGF21 Goat Polyclonal Antibody

TA303289

USD 375.00

In Stock

Goat Polyclonal Antibody against FGF21

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Peptide with sequence CQRPDGALYGSLH, from the internal region of the protein sequence according to NP_061986.1.

1 / 2

2 / 2

Previous Next

FGF2 Mouse Monoclonal Antibody [Clone ID: OTI3D9]

TA500012

USD 379.00

In Stock

bFGF (FGF2) mouse monoclonal antibody, clone OTI3D9 (formerly 3D9)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

FGF2 Mouse Monoclonal Antibody [Clone ID: OTI3D9]

TA500012S

USD 159.00

In Stock

bFGF (FGF2) mouse monoclonal antibody, clone OTI3D9 (formerly 3D9)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody [Clone ID: OTI5C7]

TA500115

USD 379.00

In Stock

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody [Clone ID: OTI5C7]

TA500115S

USD 159.00

In Stock

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

FGFR2 Mouse Monoclonal Antibody [Clone ID: OTI5C5]

TA503137

USD 379.00

In Stock

FGFR2 mouse monoclonal antibody, clone OTI5C5 (formerly 5C5)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

FGFR2 Mouse Monoclonal Antibody [Clone ID: OTI5C5]

TA503137S

USD 159.00

In Stock

FGFR2 mouse monoclonal antibody, clone OTI5C5 (formerly 5C5)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

IL1 beta (IL1B) Mouse Monoclonal Antibody [Clone ID: OTI3E1]

TA506443

USD 379.00

In Stock

IL1B mouse monoclonal antibody, clone OTI3E1 (formerly 3E1)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

IL1 beta (IL1B) Mouse Monoclonal Antibody [Clone ID: OTI3E1]

TA506443S

USD 159.00

In Stock

IL1B mouse monoclonal antibody, clone OTI3E1 (formerly 3E1)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: OTI1C1]

TA506513

USD 379.00

In Stock

TNF mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)

Applications	FC, IF, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: OTI1C1]

TA506513S

USD 159.00

2 Days

TNF mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)

Applications	FC, IF, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

TGF beta 1 (TGFB1) Mouse Monoclonal Antibody [Clone ID: OTI3B6]

TA506583

USD 379.00

In Stock

TGFB1 mouse monoclonal antibody, clone OTI3B6 (formerly 3B6)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

TGF beta 1 (TGFB1) Mouse Monoclonal Antibody [Clone ID: OTI3B6]

TA506583S

USD 159.00

In Stock

TGFB1 mouse monoclonal antibody, clone OTI3B6 (formerly 3B6)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

EGFR Mouse Monoclonal Antibody [Clone ID: UMAB95]

UM570070

USD 180.00

In Stock

EGFR mouse monoclonal antibody,clone UMAB95

Applications	10k-ChIP, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

1 - 22 of 22 results