Antibodies

Jump to Filters
View as table Download
UGT (UGT1A1) Rabbit Polyclonal Antibody
TA332982

USD 345.00

2 Weeks

Rabbit anti-UGT1A1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human UGT1A1
Aromatase (CYP19A1) Rabbit Polyclonal Antibody
TA311724

USD 345.00

In Stock

Rabbit polyclonal Cytochrome P450 19A1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 19A1.
Steroid sulfatase (STS) Rabbit Polyclonal Antibody
TA346177

USD 475.00

5 Days

Rabbit Polyclonal Anti-STS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STS antibody: synthetic peptide directed towards the middle region of human STS. Synthetic peptide located within the following region: EPTSNMDIFPTVAKLAGAPLPEDRIIDGRDLMPLLEGKSQRSDHEFLFHY
HSD11B1 Goat Polyclonal Antibody
TA302508

USD 375.00

5 Days

Goat Polyclonal Antibody against HSD11B1 / HDL

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CTSYNMDRFINK, from the C Terminus of the protein sequence according to NP_005516.1; NP_861420.1.
LCMT1 Mouse Monoclonal Antibody [Clone ID: OTI1G5]
TA503127

USD 379.00

In Stock

LCMT1 mouse monoclonal antibody, clone OTI 1G5 (formerly 1G5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
LCMT1 Mouse Monoclonal Antibody [Clone ID: OTI1G5]
TA503127S

USD 159.00

2 Days

LCMT1 mouse monoclonal antibody, clone OTI 1G5 (formerly 1G5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".