Antibodies

Jump to Filters
View as table Download
beta IV Tubulin (TUBB4A) Rabbit Polyclonal Antibody
TA340088

USD 375.00

5 Days

Rabbit Polyclonal Anti-TUBB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TUBB4 antibody: synthetic peptide directed towards the N terminal of human TUBB4. Synthetic peptide located within the following region: TYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQI
beta IV Tubulin (TUBB4A) Mouse Monoclonal Antibody [Clone ID: OTI5C1]
TA503129

USD 379.00

In Stock

Mouse monoclonal anti-TUBB4(beta IV Tubulin) antibody, clone 5C1, Loading, clone OTI5C1 (formerly 5C1)

Applications WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
beta IV Tubulin (TUBB4A) Mouse Monoclonal Antibody [Clone ID: OTI5C1]
TA503129S

USD 159.00

2 Days

Mouse monoclonal anti-TUBB4(beta IV Tubulin) antibody, clone 5C1, Loading, clone OTI5C1 (formerly 5C1)

Applications WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".