Antibodies

Jump to Filters
View as table Download
S adenosylhomocysteine hydrolase (AHCY) Rabbit Polyclonal Antibody
TA332593

USD 275.00

In Stock

Rabbit anti-AHCY Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human AHCY
CBS Rabbit Polyclonal Antibody
TA338394

USD 310.00

5 Days

Rabbit Polyclonal Anti-CBS Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen The immunogen for anti-CBS antibody: synthetic peptide directed towards the N terminal of human CBS. Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE
LCMT1 Mouse Monoclonal Antibody [Clone ID: OTI1G5]
TA503127

USD 379.00

In Stock

LCMT1 mouse monoclonal antibody, clone OTI 1G5 (formerly 1G5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
LCMT1 Mouse Monoclonal Antibody [Clone ID: OTI1G5]
TA503127S

USD 159.00

2 Days

LCMT1 mouse monoclonal antibody, clone OTI 1G5 (formerly 1G5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated