Antibodies

Jump to Filters
View as table Download
DDAH1 Rabbit Polyclonal Antibody
TA334438

USD 375.00

5 Days

Rabbit Polyclonal Anti-DDAH1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDAH1 antibody: synthetic peptide directed towards the middle region of human DDAH1. Synthetic peptide located within the following region: ALEKLQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADT