Antibodies

Jump to Filters
View as table Download
Angiopoietin 2 (ANGPT2) Rabbit Polyclonal Antibody
TA343276

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-ANGPT2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Angpt2 antibody is: synthetic peptide directed towards the middle region of Mouse Angpt2. Synthetic peptide located within the following region: NQTTRLELQLLQHSISTNKLEKQILDQTSEINKLQNKNSFLEQKVLDMEG