Rabbit Polyclonal Anti-Loxl2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Loxl2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTYYDLLSLNGTKVAEGHKA |
LOXL2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
LOXL2 mouse monoclonal antibody, clone OTI8G5 (formerly 8G5)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
LOXL2 mouse monoclonal antibody, clone OTI8G5 (formerly 8G5)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Germany
Japan
United Kingdom
China
