Antibodies

Jump to Filters
View as table Download
SOX9 Rabbit Polyclonal Antibody
TA335171

USD 375.00

5 Days

Rabbit Polyclonal Anti-SOX9 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SOX9 antibody: synthetic peptide directed towards the C terminal of human SOX9. Synthetic peptide located within the following region: AGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQ
SOX9 Mouse Monoclonal Antibody [Clone ID: OTI2H10]
TA802387

USD 379.00

In Stock

SOX9 mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated