Antibodies

Jump to Filters
View as table Download
Nicotinic Acetylcholine Receptor alpha 4 (CHRNA4) Goat Polyclonal Antibody
TA302451

USD 375.00

5 Days

Goat Polyclonal Antibody against CHRNA4 (aa29-43)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-HVETRAHAEERLLKK, from the internal region of the protein sequence according to NP_000735.1.
Nicotinic Acetylcholine Receptor alpha 4 (CHRNA4) Rabbit Polyclonal Antibody
TA330422

USD 375.00

5 Days

Rabbit Polyclonal Anti-CHRNA4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRNA4 antibody: synthetic peptide directed towards the N terminal of human CHRNA4. Synthetic peptide located within the following region: ELGGPGAPRLLPPLLLLLGTGLLRASSHVETRAHAEERLLKKLFSGYNKW
Nicotinic Acetylcholine Receptor alpha 4 (CHRNA4) Rabbit Polyclonal Antibody
TA338364

USD 375.00

5 Days

Rabbit Polyclonal Anti-CHRNA4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRNA4 antibody: synthetic peptide directed towards the N terminal of human CHRNA4. Synthetic peptide located within the following region: AEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTT