Antibodies

Jump to Filters
View as table Download
GABA A Receptor alpha 4 (GABRA4) Rabbit Polyclonal Antibody
TA313904

USD 345.00

In Stock

Rabbit polyclonal anti-GABRA4 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GABRA4.
GABA A Receptor alpha 4 (GABRA4) Goat Polyclonal Antibody
TA305622

USD 375.00

5 Days

Goat Anti-GABRA4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EKAKRKTSKPPQE, from the internal region of the protein sequence according to NP_000800.2.
GABA A Receptor alpha 4 (GABRA4) Rabbit Polyclonal Antibody
TA338503

USD 375.00

5 Days

Rabbit Polyclonal Anti-GABRA4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRA4 antibody: synthetic peptide directed towards the N terminal of human GABRA4. Synthetic peptide located within the following region: MVSAKKVPAIALSAGVSFALLRFLCLAVCLNESPGQNQKEEKLCTENFTR