Antibodies

View as table Download

Rabbit polyclonal anti-CDH23 antibody

Applications IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CDH23.

Goat Anti-CDH23 / USH1D Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-YNISLYENVTVGTS, from the internal region of the protein sequence according to NP_071407.3; NP_443068.1.

Rabbit Polyclonal Anti-CDH23 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDH23 antibody is: synthetic peptide directed towards the N-terminal region of Human CDH23. Synthetic peptide located within the following region: DHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATD

Rabbit Polyclonal Anti-CDH23 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDH23 antibody: synthetic peptide directed towards the middle region of human CDH23. Synthetic peptide located within the following region: DYISGVLTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNI

Anti-CDH23 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human cadherin-related 23cadherin-related 23

Anti-CDH23 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human cadherin-related 23