Antibodies

Jump to Filters
View as table Download
PTCH2 Rabbit Polyclonal Antibody
TA309822

USD 410.00

5 Days

Rabbit Polyclonal Patched 2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen residues 226-235 [GPFASLEGFR] of the human PTCH2 protein
PTCH2 Rabbit Polyclonal Antibody
TA338213

USD 375.00

5 Days

Rabbit Polyclonal Anti-PTCH2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTCH2 antibody: synthetic peptide directed towards the N terminal of human PTCH2. Synthetic peptide located within the following region: LAQEALPENASQQIHAFSSTTLDDILHAFSEVSAARVVGGYLLMLAYACV