Antibodies

View as table Download

VPS4A Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human VPS4A (NP_037377.1).
Modifications Unmodified

VPS4A Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human VPS4A (NP_037377.1).
Modifications Unmodified

Rabbit Polyclonal Anti-VPS4A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VPS4A antibody: synthetic peptide directed towards the N terminal of human VPS4A. Synthetic peptide located within the following region: YFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLRSKEKHGKKPVKE

Rabbit Polyclonal Anti-VPS4A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VPS4A antibody: synthetic peptide directed towards the N terminal of human VPS4A. Synthetic peptide located within the following region: LRSKEKHGKKPVKENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVMEKPN

Rabbit Polyclonal Anti-VPS4A Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human VPS4A

VPS4A rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human VPS4A