Antibodies

View as table Download

Rabbit polyclonal anti-AIM2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AIM2.

Rabbit polyclonal anti-CSRL1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CSRL1.

Goat Anti-AIM2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DKQYKSVTKPKPLSQ, from the internal region of the protein sequence according to NP_004824.1.

Rabbit Polyclonal Anti-AIM2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AIM2 antibody: synthetic peptide directed towards the N terminal of human AIM2. Synthetic peptide located within the following region: ESKYKEILLLTGLDNITDEELDRFKFFLSDEFNIATGKLHTANRIQVATL

Rabbit Polyclonal Anti-AIM2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human AIM2