Antibodies

Jump to Filters
View as table Download
BCL2A1 Rabbit Polyclonal Antibody
TA306340

USD 430.00

2 Weeks

Rabbit Polyclonal Bfl-1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Bfl-1 antibody was raised against a 14 amino acid peptide from near the amino terminus of human Bfl-1.
BCL2A1 Rabbit Polyclonal Antibody
TA306339

USD 430.00

5 Days

Rabbit Polyclonal Bfl-1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Bfl-1 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human Bfl-1.
BCL2A1 Goat Polyclonal Antibody
TA311282

USD 375.00

5 Days

Goat Anti-BCL2A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-NVVSVDTART, from the internal region of the protein sequence according to NP_004040.1; NP_001108207.1.
BCL2A1 Rabbit Polyclonal Antibody
TA330408

USD 375.00

5 Days

Rabbit Polyclonal Anti-BCL2A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BCL2A1 antibody: synthetic peptide directed towards the C terminal of human BCL2A1. Synthetic peptide located within the following region: FIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQY
BCL2A1 Rabbit Polyclonal Antibody
TA323788

USD 345.00

4 Weeks

Anti-BCL2A1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 1-175 amino acids of human BCL2-related protein A1