Antibodies

View as table Download

Rabbit Polyclonal TEM1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TEM1 antibody was raised against a 14 amino acid peptide near the carboxy terminus of the human TEM1.

Rabbit Polyclonal TEM1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TEM1 antibody was raised against a 14 amino acid peptide near the amino terminus of the human TEM1.

Rabbit Polyclonal Anti-CD248 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Cd248 antibody is: synthetic peptide directed towards the middle region of Mouse Cd248. Synthetic peptide located within the following region: DGAVSCRCSEGFRLAADGHSCEDPCAQAPCEQQCEPGGPQGYSCHCRLGF

CD248 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CD248

CD248 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 18-150 of human CD248 (NP_065137.1).
Modifications Unmodified

CD248 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 18-150 of human CD248 (NP_065137.1).
Modifications Unmodified