Rabbit Polyclonal TEM1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TEM1 antibody was raised against a 14 amino acid peptide near the carboxy terminus of the human TEM1. |
Rabbit Polyclonal TEM1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TEM1 antibody was raised against a 14 amino acid peptide near the carboxy terminus of the human TEM1. |
Rabbit Polyclonal TEM1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TEM1 antibody was raised against a 14 amino acid peptide near the amino terminus of the human TEM1. |
Rabbit Polyclonal Anti-CD248 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Cd248 antibody is: synthetic peptide directed towards the middle region of Mouse Cd248. Synthetic peptide located within the following region: DGAVSCRCSEGFRLAADGHSCEDPCAQAPCEQQCEPGGPQGYSCHCRLGF |
CD248 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CD248 |
CD248 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 18-150 of human CD248 (NP_065137.1). |
Modifications | Unmodified |
CD248 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 18-150 of human CD248 (NP_065137.1). |
Modifications | Unmodified |