Rabbit Polyclonal Anti-CDR2L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDR2L antibody: synthetic peptide directed towards the N terminal of human CDR2L. Synthetic peptide located within the following region: MRRAAGMEDFSAEEEESWYDQQDLEQDLHLAAELGKTLLERNKELEGSLQ |
Rabbit Polyclonal Anti-CDR2L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CDR2L Antibody: synthetic peptide directed towards the C terminal of human CDR2L. Synthetic peptide located within the following region: VQTSRPISRDSSWRDLRGGEEGQGEVKAGEKSLSQHVEAVDKRLEQSQPE |
Germany
Japan
United Kingdom
China