Rabbit Polyclonal Dact3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Dact3 antibody was raised against a 17 amino acid peptide from near the amino terminus of human Dact3. |
Rabbit Polyclonal Dact3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Dact3 antibody was raised against a 17 amino acid peptide from near the amino terminus of human Dact3. |
Rabbit Polyclonal Anti-DACT3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-DACT3 antibody is: synthetic peptide directed towards the C-terminal region of Human DACT3. Synthetic peptide located within the following region: AAGRRGRMAEASGRRGSPRARKASRSQSETSLLGRASAVPSGPPKYPTAE |
Rabbit Polyclonal Anti-DACT3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-DACT3 antibody is: synthetic peptide directed towards the middle region of Human DACT3. Synthetic peptide located within the following region: ALLRRRRRRGAGQPRTSPGGADGGPRRQNSVRQRPPDASPSPGSARPARE |
DACT3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DACT3 |
DACT3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DACT3 |