Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-DDAH1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDAH1 antibody: synthetic peptide directed towards the middle region of human DDAH1. Synthetic peptide located within the following region: ALEKLQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADT |
Rabbit polyclonal DDAH1 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This DDAH1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 221-250 amino acids from the C-terminal region of human DDAH1. |
Rabbit Polyclonal Anti-DDAH1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDAH1 antibody: synthetic peptide directed towards the middle region of human DDAH1. Synthetic peptide located within the following region: ALEKLQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADT |
Goat Polyclonal Antibody against DDAH1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence TCCSVLINKKVDS, from the C Terminus of the protein sequence according to NP_036269.1. |
Rabbit Polyclonal Anti-DDAH1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human DDAH1 |
DDAH1 Rabbit polyclonal Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-285 of human DDAH1 (NP_036269.1). |
| Modifications | Unmodified |
DDAH1 Rabbit polyclonal Antibody
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human DDAH1 |
Active filters
Target Symbol
- DDAH1
Clonalities
- Polyclonal
Conjugates
- Unconjugated