Antibodies

View as table Download

DLG2 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human DLG2

Rabbit polyclonal Anti-Chapsyn 110

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen GST fusion protein with a sequence VEDDYTRPPEPVYSTVNKLCDKPASPRHYSPVECDKSFLLSTPY, corresponding to amino acid residues 336-379 of rat chapsyn-110. Between PDZ2 and PDZ3 domains.

Rabbit Polyclonal Anti-DLG2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DLG2 Antibody: synthetic peptide directed towards the N terminal of human DLG2. Synthetic peptide located within the following region: MFFACYCALRTNVKKYRYQDEDAPHDHSLPRLTHEVRGPELVHVSEKNLS

Rabbit Polyclonal Anti-DLG2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human DLG2

Phospho-PSD93/chapsyn-110/DLG2-Y340 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho synthetic peptide corresponding to residues surrounding Y340 of human PSD93/chapsyn-110/DLG2.
Modifications Phospho Y340

PSD93 Rabbit polyclonal Antibody

Applications FC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human PSD93