Antibodies

View as table Download

Goat Polyclonal Antibody against DPP10

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DEGHNVSEKSKYHL, from the internal region of the protein sequence according to NP_065919.2; NP_001004360.1.

Rabbit Polyclonal DPP10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to residues 521-539 of human DPP10.

Rabbit Polyclonal Anti-DPP10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DPP10 antibody: synthetic peptide directed towards the middle region of human DPP10. Synthetic peptide located within the following region: VNYTMQVYPDEGHNVSEKSKYHLYSTILKFFSDCLKEEISVLPQEPEEDE

Rabbit Polyclonal Anti-DPP10 Antibody (Extracellular Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Dipeptidylpeptidase 10 / DPP10 antibody was raised against synthetic 14 amino acid peptide from extracellular domain of human DPP10. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig (100%); Mouse, Rat, Hamster (93%); Opossum, Chicken (86%).

DPP10 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-500 of human DPP10 (NP_001308842.1).
Modifications Unmodified