Rabbit polyclonal anti-GGN antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GGN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 139-163 amino acids from the Central region of human GGN. |
Rabbit Polyclonal Anti-GGN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GGN antibody: synthetic peptide directed towards the N terminal of human GGN. Synthetic peptide located within the following region: GPSKWQKPAGTPVPRIRRLLEASHRGQGDPPSLRPLKPPPPPRQLSVKDT |
Germany
Japan
United Kingdom
China